NARS purified MaxPab mouse polyclonal antibody (B01P)
  • NARS purified MaxPab mouse polyclonal antibody (B01P)

NARS purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004677-B01P
NARS purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NARS protein.
Información adicional
Size 50 ug
Gene Name NARS
Gene Alias ASNRS|NARS1
Gene Description asparaginyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NARS (NP_004530.1, 1 a.a. ~ 548 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4677

Enviar uma mensagem


NARS purified MaxPab mouse polyclonal antibody (B01P)

NARS purified MaxPab mouse polyclonal antibody (B01P)