NAB2 monoclonal antibody (M01), clone 4H6
  • NAB2 monoclonal antibody (M01), clone 4H6

NAB2 monoclonal antibody (M01), clone 4H6

Ref: AB-H00004665-M01
NAB2 monoclonal antibody (M01), clone 4H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NAB2.
Información adicional
Size 100 ug
Gene Name NAB2
Gene Alias MADER|MGC75085
Gene Description NGFI-A binding protein 2 (EGR1 binding protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NAB2 (NP_005958.1, 421 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4665
Clone Number 4H6
Iso type IgG2a Kappa

Enviar uma mensagem


NAB2 monoclonal antibody (M01), clone 4H6

NAB2 monoclonal antibody (M01), clone 4H6