PPP1R12B purified MaxPab mouse polyclonal antibody (B02P)
  • PPP1R12B purified MaxPab mouse polyclonal antibody (B02P)

PPP1R12B purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00004660-B02P
PPP1R12B purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPP1R12B protein.
Información adicional
Size 50 ug
Gene Name PPP1R12B
Gene Alias MGC131980|MGC87886|MYPT2
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 12B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP1R12B (ENSP00000349206, 1 a.a. ~ 386 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4660

Enviar uma mensagem


PPP1R12B purified MaxPab mouse polyclonal antibody (B02P)

PPP1R12B purified MaxPab mouse polyclonal antibody (B02P)