MYO9A polyclonal antibody (A01)
  • MYO9A polyclonal antibody (A01)

MYO9A polyclonal antibody (A01)

Ref: AB-H00004649-A01
MYO9A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MYO9A.
Información adicional
Size 50 uL
Gene Name MYO9A
Gene Alias FLJ11061|FLJ13244|MGC71859
Gene Description myosin IXA
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GKRNIHRKTGHDDTAPCAILKSMDSFSFLQHPVHQRSLEILQRCKEEKYSITRKNPRTPLSDLQGMNALNEKNQHDTFDIAWNGRTGIRQSRLSSGTSLLDKDGIFANST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYO9A (NP_008832, 719 a.a. ~ 828 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4649

Enviar uma mensagem


MYO9A polyclonal antibody (A01)

MYO9A polyclonal antibody (A01)