MYO1D polyclonal antibody (A01)
  • MYO1D polyclonal antibody (A01)

MYO1D polyclonal antibody (A01)

Ref: AB-H00004642-A01
MYO1D polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MYO1D.
Información adicional
Size 50 uL
Gene Name MYO1D
Gene Alias KIAA0727|myr4
Gene Description myosin ID
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVDGDTPLIENGKVVSIIAELLSTKTDM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYO1D (NP_056009, 211 a.a. ~ 310 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4642

Enviar uma mensagem


MYO1D polyclonal antibody (A01)

MYO1D polyclonal antibody (A01)