MYL5 purified MaxPab rabbit polyclonal antibody (D01P)
  • MYL5 purified MaxPab rabbit polyclonal antibody (D01P)

MYL5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004636-D01P
MYL5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MYL5 protein.
Información adicional
Size 100 ug
Gene Name MYL5
Gene Alias -
Gene Description myosin, light chain 5, regulatory
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MYL5 (NP_002468.1, 1 a.a. ~ 173 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4636

Enviar uma mensagem


MYL5 purified MaxPab rabbit polyclonal antibody (D01P)

MYL5 purified MaxPab rabbit polyclonal antibody (D01P)