MYL4 polyclonal antibody (A01)
  • MYL4 polyclonal antibody (A01)

MYL4 polyclonal antibody (A01)

Ref: AB-H00004635-A01
MYL4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant MYL4.
Información adicional
Size 50 uL
Gene Name MYL4
Gene Alias ALC1|AMLC|GT1|PRO1957
Gene Description myosin, light chain 4, alkali
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYL4 (AAH30228, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4635

Enviar uma mensagem


MYL4 polyclonal antibody (A01)

MYL4 polyclonal antibody (A01)