MYBL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • MYBL2 purified MaxPab rabbit polyclonal antibody (D01P)

MYBL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004605-D01P
MYBL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MYBL2 protein.
Información adicional
Size 100 ug
Gene Name MYBL2
Gene Alias B-MYB|BMYB|MGC15600
Gene Description v-myb myeloblastosis viral oncogene homolog (avian)-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWKFLASHFPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSCWTEEEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTIKRKVDTGGFLSESKDCKPPVYLLLELEDKDGLQSAQPTEGQGSLLTNWPSVPPTIKEEENSEEELAAATTSKEQE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MYBL2 (NP_002457.1, 1 a.a. ~ 700 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4605

Enviar uma mensagem


MYBL2 purified MaxPab rabbit polyclonal antibody (D01P)

MYBL2 purified MaxPab rabbit polyclonal antibody (D01P)