MYBL2 polyclonal antibody (A01)
  • MYBL2 polyclonal antibody (A01)

MYBL2 polyclonal antibody (A01)

Ref: AB-H00004605-A01
MYBL2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MYBL2.
Información adicional
Size 50 uL
Gene Name MYBL2
Gene Alias B-MYB|BMYB|MGC15600
Gene Description v-myb myeloblastosis viral oncogene homolog (avian)-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYBL2 (AAH53555, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4605

Enviar uma mensagem


MYBL2 polyclonal antibody (A01)

MYBL2 polyclonal antibody (A01)