MYBPC1 monoclonal antibody (M01), clone 3G4
  • MYBPC1 monoclonal antibody (M01), clone 3G4

MYBPC1 monoclonal antibody (M01), clone 3G4

Ref: AB-H00004604-M01
MYBPC1 monoclonal antibody (M01), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MYBPC1.
Información adicional
Size 100 ug
Gene Name MYBPC1
Gene Alias MYBPCC|MYBPCS|slow-type
Gene Description myosin binding protein C, slow type
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYBPC1 (NP_996556, 506 a.a. ~ 603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4604
Clone Number 3G4
Iso type IgG2a Kappa

Enviar uma mensagem


MYBPC1 monoclonal antibody (M01), clone 3G4

MYBPC1 monoclonal antibody (M01), clone 3G4