MX1 purified MaxPab rabbit polyclonal antibody (D01P)
  • MX1 purified MaxPab rabbit polyclonal antibody (D01P)

MX1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004599-D01P
MX1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MX1 protein.
Información adicional
Size 100 ug
Gene Name MX1
Gene Alias IFI-78K|IFI78|MX|MxA
Gene Description myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MX1 (NP_002453.1, 1 a.a. ~ 662 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4599

Enviar uma mensagem


MX1 purified MaxPab rabbit polyclonal antibody (D01P)

MX1 purified MaxPab rabbit polyclonal antibody (D01P)