MVD MaxPab rabbit polyclonal antibody (D01)
  • MVD MaxPab rabbit polyclonal antibody (D01)

MVD MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004597-D01
MVD MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MVD protein.
Información adicional
Size 100 uL
Gene Name MVD
Gene Alias FP17780|MPD
Gene Description mevalonate (diphospho) decarboxylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACLAYTLARVYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEMARCIRERDFPSFAQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MVD (NP_002452.1, 1 a.a. ~ 400 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4597

Enviar uma mensagem


MVD MaxPab rabbit polyclonal antibody (D01)

MVD MaxPab rabbit polyclonal antibody (D01)