MUTYH purified MaxPab rabbit polyclonal antibody (D01P)
  • MUTYH purified MaxPab rabbit polyclonal antibody (D01P)

MUTYH purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004595-D01P
MUTYH purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MUTYH protein.
Información adicional
Size 100 ug
Gene Name MUTYH
Gene Alias MGC4416|MYH
Gene Description mutY homolog (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTPLVSRLSRLWAIMRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDGLARQPEEVVLQASVSSYHLFRDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDLDRRAYAVWVSEVMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADPSSTLVSQQLWGLAQQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MUTYH (NP_001041636.1, 1 a.a. ~ 535 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4595

Enviar uma mensagem


MUTYH purified MaxPab rabbit polyclonal antibody (D01P)

MUTYH purified MaxPab rabbit polyclonal antibody (D01P)