MUSK monoclonal antibody (M07), clone 2H6
  • MUSK monoclonal antibody (M07), clone 2H6

MUSK monoclonal antibody (M07), clone 2H6

Ref: AB-H00004593-M07
MUSK monoclonal antibody (M07), clone 2H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MUSK.
Información adicional
Size 100 ug
Gene Name MUSK
Gene Alias MGC126323|MGC126324
Gene Description muscle, skeletal, receptor tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MUSK (NP_005583, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4593
Clone Number 2H6
Iso type IgG2b Kappa

Enviar uma mensagem


MUSK monoclonal antibody (M07), clone 2H6

MUSK monoclonal antibody (M07), clone 2H6