MUSK monoclonal antibody (M01), clone 1F3 View larger

Mouse monoclonal antibody raised against a partial recombinant MUSK.

AB-H00004593-M01

New product

MUSK monoclonal antibody (M01), clone 1F3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name MUSK
Gene Alias MGC126323|MGC126324
Gene Description muscle, skeletal, receptor tyrosine kinase
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MUSK (NP_005583, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4593
Clone Number 1F3
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant MUSK.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant MUSK.

Mouse monoclonal antibody raised against a partial recombinant MUSK.