MUC2 monoclonal antibody (M04), clone 3D10
  • MUC2 monoclonal antibody (M04), clone 3D10

MUC2 monoclonal antibody (M04), clone 3D10

Ref: AB-H00004583-M04
MUC2 monoclonal antibody (M04), clone 3D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MUC2.
Información adicional
Size 100 ug
Gene Name MUC2
Gene Alias MLP|SMUC
Gene Description mucin 2, oligomeric mucus/gel-forming
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MUC2 (NP_002448, 5081 a.a. ~ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4583
Clone Number 3D10
Iso type IgG2a Kappa

Enviar uma mensagem


MUC2 monoclonal antibody (M04), clone 3D10

MUC2 monoclonal antibody (M04), clone 3D10