MTR polyclonal antibody (A01)
  • MTR polyclonal antibody (A01)

MTR polyclonal antibody (A01)

Ref: AB-H00004548-A01
MTR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MTR.
Información adicional
Size 50 uL
Gene Name MTR
Gene Alias FLJ33168|FLJ43216|FLJ45386|MS
Gene Description 5-methyltetrahydrofolate-homocysteine methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTR (NP_000245, 1094 a.a. ~ 1203 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4548

Enviar uma mensagem


MTR polyclonal antibody (A01)

MTR polyclonal antibody (A01)