NUDT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NUDT1 purified MaxPab rabbit polyclonal antibody (D01P)

NUDT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004521-D01P
NUDT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NUDT1 protein.
Información adicional
Size 100 ug
Gene Name NUDT1
Gene Alias MTH1
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NUDT1 (NP_002443.3, 1 a.a. ~ 156 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4521

Enviar uma mensagem


NUDT1 purified MaxPab rabbit polyclonal antibody (D01P)

NUDT1 purified MaxPab rabbit polyclonal antibody (D01P)