View larger
Rabbit polyclonal antibody raised against a full-length human NUDT1 protein.
AB-H00004521-D01
New product
NUDT1 MaxPab rabbit polyclonal antibody (D01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | NUDT1 |
| Gene Alias | MTH1 |
| Gene Description | nudix (nucleoside diphosphate linked moiety X)-type motif 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr,IP |
| Immunogen Prot. Seq | MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | NUDT1 (NP_002443.3, 1 a.a. ~ 156 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 4521 |
More info
Rabbit polyclonal antibody raised against a full-length human NUDT1 protein.