MTCP1 monoclonal antibody (M05), clone 1G12
  • MTCP1 monoclonal antibody (M05), clone 1G12

MTCP1 monoclonal antibody (M05), clone 1G12

Ref: AB-H00004515-M05
MTCP1 monoclonal antibody (M05), clone 1G12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MTCP1.
Información adicional
Size 100 ug
Gene Name MTCP1
Gene Alias C6.1B|P13MTCP1
Gene Description mature T-cell proliferation 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTCP1 (AAH02600, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4515
Clone Number 1G12
Iso type IgG2b Kappa

Enviar uma mensagem


MTCP1 monoclonal antibody (M05), clone 1G12

MTCP1 monoclonal antibody (M05), clone 1G12