MTAP monoclonal antibody (M01J), clone 2G4
  • MTAP monoclonal antibody (M01J), clone 2G4

MTAP monoclonal antibody (M01J), clone 2G4

Ref: AB-H00004507-M01J
MTAP monoclonal antibody (M01J), clone 2G4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MTAP.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 50 ug
Gene Name MTAP
Gene Alias MSAP|c86fus
Gene Description methylthioadenosine phosphorylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4507
Clone Number 2G4
Iso type IgG1 Kappa

Enviar uma mensagem


MTAP monoclonal antibody (M01J), clone 2G4

MTAP monoclonal antibody (M01J), clone 2G4