MST1R monoclonal antibody (M10), clone 3H2
  • MST1R monoclonal antibody (M10), clone 3H2

MST1R monoclonal antibody (M10), clone 3H2

Ref: AB-H00004486-M10
MST1R monoclonal antibody (M10), clone 3H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MST1R.
Información adicional
Size 100 ug
Gene Name MST1R
Gene Alias CD136|CDw136|PTK8|RON
Gene Description macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MST1R (NP_002438, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4486
Clone Number 3H2
Iso type IgG2a Kappa

Enviar uma mensagem


MST1R monoclonal antibody (M10), clone 3H2

MST1R monoclonal antibody (M10), clone 3H2