MST1 polyclonal antibody (A01)
  • MST1 polyclonal antibody (A01)

MST1 polyclonal antibody (A01)

Ref: AB-H00004485-A01
MST1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MST1.
Información adicional
Size 50 uL
Gene Name MST1
Gene Alias D3F15S2|DNF15S2|HGFL|MSP|NF15S2
Gene Description macrophage stimulating 1 (hepatocyte growth factor-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MST1 (AAH48330, 19 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4485

Enviar uma mensagem


MST1 polyclonal antibody (A01)

MST1 polyclonal antibody (A01)