View larger
Mouse monoclonal antibody raised against a partial recombinant MSRA.
AB-H00004482-M01
New product
MSRA monoclonal antibody (M01), clone 3C11
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | MSRA |
| Gene Alias | - |
| Gene Description | methionine sulfoxide reductase A |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYT |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MSRA (NP_036463.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 4482 |
| Clone Number | 3C11 |
| Iso type | IgM Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant MSRA.