MSRA purified MaxPab rabbit polyclonal antibody (D01P)
  • MSRA purified MaxPab rabbit polyclonal antibody (D01P)

MSRA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004482-D01P
MSRA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MSRA protein.
Información adicional
Size 100 ug
Gene Name MSRA
Gene Alias -
Gene Description methionine sulfoxide reductase A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MSRA (NP_036463.1, 1 a.a. ~ 235 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4482

Enviar uma mensagem


MSRA purified MaxPab rabbit polyclonal antibody (D01P)

MSRA purified MaxPab rabbit polyclonal antibody (D01P)