MSI1 purified MaxPab mouse polyclonal antibody (B01P)
  • MSI1 purified MaxPab mouse polyclonal antibody (B01P)

MSI1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004440-B01P
MSI1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MSI1 protein.
Información adicional
Size 50 ug
Gene Name MSI1
Gene Alias -
Gene Description musashi homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MSI1 (NP_002433.1, 1 a.a. ~ 362 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4440

Enviar uma mensagem


MSI1 purified MaxPab mouse polyclonal antibody (B01P)

MSI1 purified MaxPab mouse polyclonal antibody (B01P)