CITED1 monoclonal antibody (M02), clone 6C1
  • CITED1 monoclonal antibody (M02), clone 6C1

CITED1 monoclonal antibody (M02), clone 6C1

Ref: AB-H00004435-M02
CITED1 monoclonal antibody (M02), clone 6C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CITED1.
Información adicional
Size 100 ug
Gene Name CITED1
Gene Alias MSG1
Gene Description Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4435
Clone Number 6C1
Iso type IgG2a Kappa

Enviar uma mensagem


CITED1 monoclonal antibody (M02), clone 6C1

CITED1 monoclonal antibody (M02), clone 6C1