MPV17 purified MaxPab mouse polyclonal antibody (B01P)
  • MPV17 purified MaxPab mouse polyclonal antibody (B01P)

MPV17 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004358-B01P
MPV17 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MPV17 protein.
Información adicional
Size 50 ug
Gene Name MPV17
Gene Alias SYM1
Gene Description MpV17 mitochondrial inner membrane protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MPV17 (NP_002428.1, 1 a.a. ~ 176 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4358

Enviar uma mensagem


MPV17 purified MaxPab mouse polyclonal antibody (B01P)

MPV17 purified MaxPab mouse polyclonal antibody (B01P)