MPST purified MaxPab rabbit polyclonal antibody (D01P)
  • MPST purified MaxPab rabbit polyclonal antibody (D01P)

MPST purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004357-D01P
MPST purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MPST protein.
Información adicional
Size 100 ug
Gene Name MPST
Gene Alias MGC24539|MST|TST2
Gene Description mercaptopyruvate sulfurtransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTAC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MPST (NP_066949.1, 1 a.a. ~ 297 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4357

Enviar uma mensagem


MPST purified MaxPab rabbit polyclonal antibody (D01P)

MPST purified MaxPab rabbit polyclonal antibody (D01P)