MPI purified MaxPab mouse polyclonal antibody (B01P)
  • MPI purified MaxPab mouse polyclonal antibody (B01P)

MPI purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004351-B01P
MPI purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MPI protein.
Información adicional
Size 50 ug
Gene Name MPI
Gene Alias FLJ39201|PMI|PMI1
Gene Description mannose phosphate isomerase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MPI (NP_002426.1, 1 a.a. ~ 423 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4351

Enviar uma mensagem


MPI purified MaxPab mouse polyclonal antibody (B01P)

MPI purified MaxPab mouse polyclonal antibody (B01P)