MPG monoclonal antibody (M07), clone 2C5
  • MPG monoclonal antibody (M07), clone 2C5

MPG monoclonal antibody (M07), clone 2C5

Ref: AB-H00004350-M07
MPG monoclonal antibody (M07), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MPG.
Información adicional
Size 100 ug
Gene Name MPG
Gene Alias AAG|APNG|CRA36.1|MDG|Mid1|PIG11|PIG16|anpg
Gene Description N-methylpurine-DNA glycosylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4350
Clone Number 2C5
Iso type IgG2a Kappa

Enviar uma mensagem


MPG monoclonal antibody (M07), clone 2C5

MPG monoclonal antibody (M07), clone 2C5