MOG MaxPab rabbit polyclonal antibody (D01)
  • MOG MaxPab rabbit polyclonal antibody (D01)

MOG MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004340-D01
MOG MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MOG protein.
Información adicional
Size 100 uL
Gene Name MOG
Gene Alias MGC26137|MOGIG-2
Gene Description myelin oligodendrocyte glycoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRKFSSLCYKQRI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MOG (AAH35938.1, 1 a.a. ~ 295 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4340

Enviar uma mensagem


MOG MaxPab rabbit polyclonal antibody (D01)

MOG MaxPab rabbit polyclonal antibody (D01)