MOBP monoclonal antibody (M01A), clone 1H3
  • MOBP monoclonal antibody (M01A), clone 1H3

MOBP monoclonal antibody (M01A), clone 1H3

Ref: AB-H00004336-M01A
MOBP monoclonal antibody (M01A), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant MOBP.
Información adicional
Size 200 uL
Gene Name MOBP
Gene Alias MGC87379
Gene Description myelin-associated oligodendrocyte basic protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MOBP (AAH22471, 1 a.a. ~ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 4336
Clone Number 1H3
Iso type IgM Kappa

Enviar uma mensagem


MOBP monoclonal antibody (M01A), clone 1H3

MOBP monoclonal antibody (M01A), clone 1H3