MNDA monoclonal antibody (M01), clone 1H2
  • MNDA monoclonal antibody (M01), clone 1H2

MNDA monoclonal antibody (M01), clone 1H2

Ref: AB-H00004332-M01
MNDA monoclonal antibody (M01), clone 1H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MNDA.
Información adicional
Size 100 ug
Gene Name MNDA
Gene Alias PYHIN3
Gene Description myeloid cell nuclear differentiation antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq QLYKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDVVGSGKWHNIKCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MNDA (NP_002423.1, 311 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4332
Clone Number 1H2
Iso type IgG2a Kappa

Enviar uma mensagem


MNDA monoclonal antibody (M01), clone 1H2

MNDA monoclonal antibody (M01), clone 1H2