MMP14 purified MaxPab rabbit polyclonal antibody (D01P)
  • MMP14 purified MaxPab rabbit polyclonal antibody (D01P)

MMP14 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004323-D01P
MMP14 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MMP14 protein.
Información adicional
Size 100 ug
Gene Name MMP14
Gene Alias MMP-X1|MT1-MMP|MTMMP1
Gene Description matrix metallopeptidase 14 (membrane-inserted)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMP14 (AAH64803.1, 1 a.a. ~ 582 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4323

Enviar uma mensagem


MMP14 purified MaxPab rabbit polyclonal antibody (D01P)

MMP14 purified MaxPab rabbit polyclonal antibody (D01P)