MMP10 purified MaxPab rabbit polyclonal antibody (D01P)
  • MMP10 purified MaxPab rabbit polyclonal antibody (D01P)

MMP10 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004319-D01P
MMP10 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MMP10 protein.
Información adicional
Size 100 ug
Gene Name MMP10
Gene Alias SL-2|STMY2
Gene Description matrix metallopeptidase 10 (stromelysin 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQFRRKDSNLIVKKIQGMQKFLGLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMP10 (NP_002416.1, 1 a.a. ~ 476 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4319

Enviar uma mensagem


MMP10 purified MaxPab rabbit polyclonal antibody (D01P)

MMP10 purified MaxPab rabbit polyclonal antibody (D01P)