MMP9 monoclonal antibody (M03), clone 2H4
  • MMP9 monoclonal antibody (M03), clone 2H4

MMP9 monoclonal antibody (M03), clone 2H4

Ref: AB-H00004318-M03
MMP9 monoclonal antibody (M03), clone 2H4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MMP9.
Información adicional
Size 100 ug
Gene Name MMP9
Gene Alias CLG4B|GELB|MMP-9
Gene Description matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,PLA-Ce,IF
Immunogen Prot. Seq MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MMP9 (AAH06093.1, 1 a.a. ~ 707 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4318
Clone Number 2H4
Iso type IgG1 Kappa

Enviar uma mensagem


MMP9 monoclonal antibody (M03), clone 2H4

MMP9 monoclonal antibody (M03), clone 2H4