MMP7 MaxPab rabbit polyclonal antibody (D01)
  • MMP7 MaxPab rabbit polyclonal antibody (D01)

MMP7 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004316-D01
MMP7 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MMP7 protein.
Información adicional
Size 100 uL
Gene Name MMP7
Gene Alias MMP-7|MPSL1|PUMP-1
Gene Description matrix metallopeptidase 7 (matrilysin, uterine)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMP7 (NP_002414.1, 1 a.a. ~ 267 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4316

Enviar uma mensagem


MMP7 MaxPab rabbit polyclonal antibody (D01)

MMP7 MaxPab rabbit polyclonal antibody (D01)