MMP7 polyclonal antibody (A01)
  • MMP7 polyclonal antibody (A01)

MMP7 polyclonal antibody (A01)

Ref: AB-H00004316-A01
MMP7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MMP7.
Información adicional
Size 50 uL
Gene Name MMP7
Gene Alias MMP-7|MPSL1|PUMP-1
Gene Description matrix metallopeptidase 7 (matrilysin, uterine)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MMP7 (NP_002414, 95 a.a. ~ 204 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4316

Enviar uma mensagem


MMP7 polyclonal antibody (A01)

MMP7 polyclonal antibody (A01)