MMP1 purified MaxPab mouse polyclonal antibody (B01P)
  • MMP1 purified MaxPab mouse polyclonal antibody (B01P)

MMP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004312-B01P
MMP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MMP1 protein.
Información adicional
Size 50 ug
Gene Name MMP1
Gene Alias CLG|CLGN
Gene Description matrix metallopeptidase 1 (interstitial collagenase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMP1 (NP_002412.1, 1 a.a. ~ 469 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4312

Enviar uma mensagem


MMP1 purified MaxPab mouse polyclonal antibody (B01P)

MMP1 purified MaxPab mouse polyclonal antibody (B01P)