MLLT6 monoclonal antibody (M03), clone 1D9 View larger

Mouse monoclonal antibody raised against a full length recombinant MLLT6.

AB-H00004302-M03

New product

MLLT6 monoclonal antibody (M03), clone 1D9

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name MLLT6
Gene Alias AF17|FLJ23480
Gene Description myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MLLT6 (AAH07237, 1 a.a. ~ 462 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4302
Clone Number 1D9
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a full length recombinant MLLT6.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full length recombinant MLLT6.

Mouse monoclonal antibody raised against a full length recombinant MLLT6.