MLLT1 purified MaxPab mouse polyclonal antibody (B01P)
  • MLLT1 purified MaxPab mouse polyclonal antibody (B01P)

MLLT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004298-B01P
MLLT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MLLT1 protein.
Información adicional
Size 50 ug
Gene Name MLLT1
Gene Alias ENL|LTG19|YEATS1
Gene Description myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYAGFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MLLT1 (AAI48807.1, 1 a.a. ~ 559 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4298

Enviar uma mensagem


MLLT1 purified MaxPab mouse polyclonal antibody (B01P)

MLLT1 purified MaxPab mouse polyclonal antibody (B01P)