MICB MaxPab rabbit polyclonal antibody (D01)
  • MICB MaxPab rabbit polyclonal antibody (D01)

MICB MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004277-D01
MICB MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MICB protein.
Información adicional
Size 100 uL
Gene Name MICB
Gene Alias PERB11.2
Gene Description MHC class I polypeptide-related sequence B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MICB (AAH44218.1, 1 a.a. ~ 340 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4277

Enviar uma mensagem


MICB MaxPab rabbit polyclonal antibody (D01)

MICB MaxPab rabbit polyclonal antibody (D01)