View larger
Rabbit polyclonal antibody raised against a full-length human MICB protein.
AB-H00004277-D01
New product
MICB MaxPab rabbit polyclonal antibody (D01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | MICB |
| Gene Alias | PERB11.2 |
| Gene Description | MHC class I polypeptide-related sequence B |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP |
| Immunogen Prot. Seq | MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSG |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | MICB (AAH44218.1, 1 a.a. ~ 340 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 4277 |
More info
Rabbit polyclonal antibody raised against a full-length human MICB protein.