MICB purified MaxPab mouse polyclonal antibody (B01P)
  • MICB purified MaxPab mouse polyclonal antibody (B01P)

MICB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004277-B01P
MICB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MICB protein.
Información adicional
Size 50 ug
Gene Name MICB
Gene Alias PERB11.2
Gene Description MHC class I polypeptide-related sequence B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MICB (AAH44218.1, 1 a.a. ~ 340 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4277

Enviar uma mensagem


MICB purified MaxPab mouse polyclonal antibody (B01P)

MICB purified MaxPab mouse polyclonal antibody (B01P)