CD99 purified MaxPab rabbit polyclonal antibody (D01P)
  • CD99 purified MaxPab rabbit polyclonal antibody (D01P)

CD99 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004267-D01P
CD99 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD99 protein.
Información adicional
Size 100 ug
Gene Name CD99
Gene Alias MIC2|MIC2X|MIC2Y
Gene Description CD99 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD99 (NP_002405.1, 1 a.a. ~ 185 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4267

Enviar uma mensagem


CD99 purified MaxPab rabbit polyclonal antibody (D01P)

CD99 purified MaxPab rabbit polyclonal antibody (D01P)