MGST3 purified MaxPab rabbit polyclonal antibody (D01P)
  • MGST3 purified MaxPab rabbit polyclonal antibody (D01P)

MGST3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004259-D01P
MGST3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MGST3 protein.
Información adicional
Size 100 ug
Gene Name MGST3
Gene Alias GST-III
Gene Description microsomal glutathione S-transferase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MGST3 (NP_004519.1, 1 a.a. ~ 152 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4259

Enviar uma mensagem


MGST3 purified MaxPab rabbit polyclonal antibody (D01P)

MGST3 purified MaxPab rabbit polyclonal antibody (D01P)