MGST3 polyclonal antibody (A01)
  • MGST3 polyclonal antibody (A01)

MGST3 polyclonal antibody (A01)

Ref: AB-H00004259-A01
MGST3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MGST3.
Información adicional
Size 50 uL
Gene Name MGST3
Gene Alias GST-III
Gene Description microsomal glutathione S-transferase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MGST3 (NP_004519, 28 a.a. ~ 84 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4259

Enviar uma mensagem


MGST3 polyclonal antibody (A01)

MGST3 polyclonal antibody (A01)