SCGB2A2 monoclonal antibody (M08), clone 3A4
  • SCGB2A2 monoclonal antibody (M08), clone 3A4

SCGB2A2 monoclonal antibody (M08), clone 3A4

Ref: AB-H00004250-M08
SCGB2A2 monoclonal antibody (M08), clone 3A4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SCGB2A2.
Información adicional
Size 100 ug
Gene Name SCGB2A2
Gene Alias MGB1|MGC71974|UGB2
Gene Description secretoglobin, family 2A, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCGB2A2 (NP_002402.1, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4250
Clone Number 3A4
Iso type IgG2a Kappa

Enviar uma mensagem


SCGB2A2 monoclonal antibody (M08), clone 3A4

SCGB2A2 monoclonal antibody (M08), clone 3A4