SCGB2A1 monoclonal antibody (M01), clone 1G10
  • SCGB2A1 monoclonal antibody (M01), clone 1G10

SCGB2A1 monoclonal antibody (M01), clone 1G10

Ref: AB-H00004246-M01
SCGB2A1 monoclonal antibody (M01), clone 1G10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SCGB2A1.
Información adicional
Size 100 ug
Gene Name SCGB2A1
Gene Alias LPHC|MGB2|MGC71973|UGB3
Gene Description secretoglobin, family 2A, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCGB2A1 (NP_002398.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4246
Clone Number 1G10
Iso type IgG1 Kappa

Enviar uma mensagem


SCGB2A1 monoclonal antibody (M01), clone 1G10

SCGB2A1 monoclonal antibody (M01), clone 1G10