MFNG monoclonal antibody (M07), clone 2B11
  • MFNG monoclonal antibody (M07), clone 2B11

MFNG monoclonal antibody (M07), clone 2B11

Ref: AB-H00004242-M07
MFNG monoclonal antibody (M07), clone 2B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MFNG.
Información adicional
Size 100 ug
Gene Name MFNG
Gene Alias -
Gene Description MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MFNG (NP_002396, 214 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4242
Clone Number 2B11
Iso type IgG2a Kappa

Enviar uma mensagem


MFNG monoclonal antibody (M07), clone 2B11

MFNG monoclonal antibody (M07), clone 2B11